PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00122.1_g00024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 485aa    MW: 55462.6 Da    PI: 9.8616
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00122.1_g00024.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.71.2e-14693197
                             EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                       B3  1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85
                             ffk l     + ++ l++p  f++++  g ++   +  +l++  s  +Wevk+  + ++ r  lt+GWkeF+ a++L+ gD+++F+ +
  Rsa1.0_00122.1_g00024.1  6 FFKPL--LPGFHTH-LTIPVAFFSKYiqGRNE--RTAAKLRSdASKITWEVKI--EDGR-R--LTDGWKEFALAHDLRIGDILIFRQE 83
                             66666..5666676.***********955444..4567777758889******..4444.3..9**********************77 PP

                             SSSEE..EEEEE CS
                       B3 86 grsefelvvkvf 97
                             +++ f  +v+++
  Rsa1.0_00122.1_g00024.1 84 KDMAF--HVTLL 93
                             76777..77665 PP

2B3642.3e-20136227397
                              EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                       B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                               +++++ +l+++ l lp++f++e+g+ ++++ ++ l++e+g+sW++ l+ +   g++++++GW++F+ angLk+g   +Fkl++ +
  Rsa1.0_00122.1_g00024.1 136 VAFVSPATLRHDKLNLPRSFVRENGLGTRCG-EILLMNEKGKSWTLALK-QELCGSTYIRRGWRSFCGANGLKTGGLYTFKLVQ-R 218
                              567889999***************9999887.****************3.55556699************************99.5 PP

                              EE..EEEEE CS
                       B3  89 efelvvkvf 97 
                              ++++v+++ 
  Rsa1.0_00122.1_g00024.1 219 GRTPVLRLS 227
                              666777765 PP

3B371.41.1e-22287375696
                              ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                       B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                              +++++l+++rl l+k+f++e+g+++ +s +++l +e+g sW+++l+ +++ g++++t GW++F++ ngL++g  ++Fkl++r +++
  Rsa1.0_00122.1_g00024.1 287 VTPSSLQEDRLNLSKSFVRENGLET-RSGEIVLINEKGTSWKLNLKRKNSCGTMYITPGWRSFCRVNGLRAGSYFTFKLIQR-RGT 370
                              68899999*************9996.556****************98888888***************************95.555 PP

                              .EEEE CS
                       B3  92 lvvkv 96 
                              lv+++
  Rsa1.0_00122.1_g00024.1 371 LVLHL 375
                              66665 PP

4B354.52.1e-17384476296
                              EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                       B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                              ++ +++++ l+s  l lp +f+++hg++  e++++tl d++g +W  +l+ +k+s+r+ l +GW+eF +an ++ g++ ++kl+++
  Rsa1.0_00122.1_g00024.1 384 VSLTLKPSILTSYSLFLPLHFTKRHGIN--EKTKMTLLDKNGVKWFTNLRSEKTSDRVRLVGGWREFFEANCVEMGESTILKLIWE 467
                              55666788888889***********999..4569***************************************************9 PP

                              SEE..EEEE CS
                       B3  88 sefelvvkv 96 
                               ++++v+k+
  Rsa1.0_00122.1_g00024.1 468 GDKSCVLKF 476
                              888788776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.464396IPR003340B3 DNA binding domain
CDDcd100177.59E-14493No hitNo description
SuperFamilySSF1019367.65E-194103IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.5E-226109IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.6E-21696IPR003340B3 DNA binding domain
PfamPF023623.3E-101489IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-19130227IPR015300DNA-binding pseudobarrel domain
CDDcd100171.42E-16132226No hitNo description
SuperFamilySSF1019367.26E-18132231IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.157134229IPR003340B3 DNA binding domain
PfamPF023623.5E-19135227IPR003340B3 DNA binding domain
SMARTSM010191.1E-25135230IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-21275373IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-20280375IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.439282379IPR003340B3 DNA binding domain
CDDcd100173.46E-20282375No hitNo description
SMARTSM010192.0E-27283378IPR003340B3 DNA binding domain
PfamPF023624.2E-20286376IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.1E-17377474IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-18380472IPR015300DNA-binding pseudobarrel domain
PfamPF023623.6E-16383478IPR003340B3 DNA binding domain
SMARTSM010196.7E-19383480IPR003340B3 DNA binding domain
PROSITE profilePS5086313.028383480IPR003340B3 DNA binding domain
CDDcd100172.74E-16383476No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MLNKRFFKPL LPGFHTHLTI PVAFFSKYIQ GRNERTAAKL RSDASKITWE VKIEDGRRLT  60
DGWKEFALAH DLRIGDILIF RQEKDMAFHV TLLGPSCCEI QYESCPEEEN NIGNIPKKKN  120
PRKEKEIASL DPSCFVAFVS PATLRHDKLN LPRSFVRENG LGTRCGEILL MNEKGKSWTL  180
ALKQELCGST YIRRGWRSFC GANGLKTGGL YTFKLVQRGR TPVLRLSSTD SELEEESSEG  240
DEVESLSTEP ESDEGTKTNF EKIQRKKNPK RDAESSSLDH SCYVANVTPS SLQEDRLNLS  300
KSFVRENGLE TRSGEIVLIN EKGTSWKLNL KRKNSCGTMY ITPGWRSFCR VNGLRAGSYF  360
TFKLIQRRGT LVLHLSSQFE NKFVSLTLKP SILTSYSLFL PLHFTKRHGI NEKTKMTLLD  420
KNGVKWFTNL RSEKTSDRVR LVGGWREFFE ANCVEMGEST ILKLIWEGDK SCVLKFWSKV  480
KHETK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894339e-63AC189433.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068H20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140574.10.0PREDICTED: putative B3 domain-containing protein REM15
SwissprotO230760.0REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLA0A0D3C1U70.0A0A0D3C1U7_BRAOL; Uncharacterized protein
STRINGBra032075.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-179B3 family protein